Structure of PDB 1ign Chain A

Receptor sequence

>1ignA (length=189) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRV
YLSKRLEYVYEVDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTLAI
AVKKQFYRDLFQIDPDTGRSLIRTQSRRGPIAREFFKHFAEEHAAHTENA
WRDRFRKFLLAYGIDDYISYYEAEEPMKNLTPTPGNYNS

3D structure

PDB

1ign The crystal structure of the DNA-binding domain of yeast RAP1 in complex with telomeric DNA.

Chain

Resolution

2.25 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	K360 A361 S362 F363 H398 T399 N401 S402 H405 R406 Y410 K446 R447 F449 H536 T537 N539 D543 R544 F548 K575 N576 T578 T588 P589 G590 N591 N593 S594	K1 A2 S3 F4 H39 T40 N42 S43 H46 R47 Y51 K87 R88 F90 H146 T147 N149 D153 R154 F158 K178 N179 T181 T183 P184 G185 N186 N188 S189	PDBbind-CN: Kd=13pM
BS02	dna	A	K360 T383 T384 H385 T386 R404 R408 S444 I445 K446 R518 P520 I521 R523 E524 E538 R542 R546 P589 G590	K1 T24 T25 H26 T27 R45 R49 S85 I86 K87 R128 P130 I131 R133 E134 E148 R152 R156 P184 G185	PDBbind-CN: Kd=13pM

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0000723	telomere maintenance

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1ign, PDBe:1ign, PDBj:1ign
PDBsum	1ign
PubMed	8620531
UniProt	P11938\|RAP1_YEAST DNA-binding protein RAP1 (Gene Name=RAP1)

[Back to BioLiP]