Structure of PDB 1idh Chain A |
>1idhA (length=74) Species: 8616 (Bungarus multicinctus) [Search protein sequence] |
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPS KKPYEEVTCCSTDKCNPHPKQRPG |
|
PDB | 1idh The solution structure of the complex formed between alpha-bungarotoxin and an 18-mer cognate peptide derived from the alpha 1 subunit of the nicotinic acetylcholine receptor from Torpedo californica. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
|
|
|