Structure of PDB 1id3 Chain A

Receptor sequence
>1id3A (length=97) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
PHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKEIKLARRLRGER
3D structure
PDB1id3 Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.
ChainA
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna A Y41 K42 P43 T45 R72 R83 F84 S86 R116 V117 T118 Q120 Y4 K5 P6 T8 R35 R46 F47 S49 R79 V80 T81 Q83
BS02 dna A R40 Y41 G44 V46 R49 R63 K64 L65 P66 R69 R83 R3 Y4 G7 V9 R12 R26 K27 L28 P29 R32 R46
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0008823 cupric reductase (NADH) activity
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
GO:0006878 intracellular copper ion homeostasis
GO:0009060 aerobic respiration
GO:0009303 rRNA transcription
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
GO:0043935 sexual sporulation resulting in formation of a cellular spore
GO:0045943 positive regulation of transcription by RNA polymerase I
GO:0070911 global genome nucleotide-excision repair
Cellular Component
GO:0000500 RNA polymerase I upstream activating factor complex
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex
GO:0043505 CENP-A containing nucleosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1id3, PDBe:1id3, PDBj:1id3
PDBsum1id3
PubMed11566884
UniProtP61830|H3_YEAST Histone H3 (Gene Name=HHT1)

[Back to BioLiP]