Structure of PDB 1id2 Chain A |
>1id2A (length=106) Species: 34007 (Paracoccus versutus) [Search protein sequence] |
QDKITVTSEKPVAAADVPADAVVVGIEKMKYLTPEVTIKAGETVYWVNGE VMPHNVAFKKGIVGEDAFRGEMMTKDQAYAITFNEAGSYDYFCTPHPFMR GKVIVE |
|
PDB | 1id2 Crystal structure analysis and refinement at 2.15 A resolution of amicyanin, a type I blue copper protein, from Thiobacillus versutus. |
Chain | A |
Resolution | 2.15 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
H54 C93 H96 |
Catalytic site (residue number reindexed from 1) |
H54 C93 H96 |
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H54 C93 H96 |
H54 C93 H96 |
|
|
|
|