Structure of PDB 1ibw Chain A |
>1ibwA (length=81) Species: 1593 (Lactobacillus sp. 30A) [Search protein sequence] |
SELDAKLNKLGVDRIAISPYKQWTRGYMEPGNIGNGYVTGLKVDAGVRDK SDNNVLDGIVSYDRAETKNAYIGQINMTTAS |
|
PDB | 1ibw Structure and cooperativity of a T-state mutant of histidine decarboxylase from Lactobacillus 30a. |
Chain | A |
Resolution | 3.2 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PVH |
A |
Y62 D63 |
Y62 D63 |
|
|
|
|