Structure of PDB 1ibe Chain A

Receptor sequence

>1ibeA (length=141) Species: 9796 (Equus caballus)

VLSAADKTNVKAAWSKVGGHAGEFGAEALERMFLGFPTTKTYFPHFDLSH
GSAQVKAHGKKVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKL
LSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVSTVLTSKYR

3D structure

• PDB: 1ibe The crystal structure of horse deoxyhaemoglobin trapped in the high-affinity (R) state.
• Chain: A
• Resolution: 1.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	Y42 F43 H45 H58 K61 H87 L91 N97 L136	Y42 F43 H45 H58 K61 H87 L91 N97 L136

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex

External links

• PDB: RCSB:1ibe, PDBe:1ibe, PDBj:1ibe
• PDBsum: 1ibe
• PubMed: 8980683
• UniProt: P01958|HBA_HORSE Hemoglobin subunit alpha (Gene Name=HBA)