Structure of PDB 1iau Chain A

Receptor sequence
>1iauA (length=226) Species: 9606 (Homo sapiens) [Search protein sequence]
IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSI
NVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKR
TRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQED
RKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYG
RNNGMPPRACTKVSSFVHWIKKTMKR
3D structure
PDB1iau The three-dimensional structure of human granzyme B compared to caspase-3, key mediators of cell death with cleavage specificity for aspartic acid in P1.
ChainA
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 K192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H44 D88 K180 G181 D182 S183 G184
Enzyme Commision number 3.4.21.79: granzyme B.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A H57 F99 Y174 F191 K192 G193 D194 S195 S214 Y215 G216 R217 N218 H44 F85 Y160 F179 K180 G181 D182 S183 S198 Y199 G200 R201 N202
BS02 ZN A H151 H153 H136 H138
BS03 ZN A H25 E77 H10 E63
BS04 ZN A H20 E157 H5 E142
BS05 ZN A D184 E186 D171 E173
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005515 protein binding
GO:0008236 serine-type peptidase activity
Biological Process
GO:0006508 proteolysis
GO:0006915 apoptotic process
GO:0017148 negative regulation of translation
GO:0031640 killing of cells of another organism
GO:0042267 natural killer cell mediated cytotoxicity
GO:0051603 proteolysis involved in protein catabolic process
GO:0051604 protein maturation
GO:0070269 pyroptotic inflammatory response
GO:0140507 granzyme-mediated programmed cell death signaling pathway
GO:1903749 positive regulation of establishment of protein localization to mitochondrion
Cellular Component
GO:0001772 immunological synapse
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005829 cytosol
GO:0016020 membrane
GO:0043231 intracellular membrane-bounded organelle
GO:0044194 cytolytic granule
GO:1904856 cytolytic granule lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1iau, PDBe:1iau, PDBj:1iau
PDBsum1iau
PubMed11325591
UniProtP10144|GRAB_HUMAN Granzyme B (Gene Name=GZMB)

[Back to BioLiP]