Structure of PDB 1i77 Chain A

Receptor sequence

>1i77A (length=107) Species: 876 (Desulfovibrio desulfuricans) [Search protein sequence]

APAAPDKPLEFKGSQKTVMFPHAVHAKVECVTCHHQVDGKESFAKCGSSG
CHDDLAGKQGEKSLYYVVHTKKELKHTNCIGCHSKVVEGKPELKKDLTAC
AKSKCHP

3D structure

PDB

1i77 Spectroscopic investigation and determination of reactivity and structure of the tetraheme cytochrome c3 from Desulfovibrio desulfuricans Essex 6.

Chain

Resolution

1.95 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEM	A	P5 L9 F11 F20 H22 H25 V28 C30 C33 H34 F43 K45 C46	P5 L9 F11 F20 H22 H25 V28 C30 C33 H34 F43 K45 C46
BS02	HEM	A	H35 A44 C46 C51 H52 E61 L74 K75 H76	H35 A44 C46 C51 H52 E61 L74 K75 H76
BS03	HEM	A	F20 H25 C79 C82 H83 L97	F20 H25 C79 C82 H83 L97
BS04	HEM	A	F11 G13 S14 Q15 K16 V18 Y65 V68 H69 I80 H83 T98 C100 C105 H106	F11 G13 S14 Q15 K16 V18 Y65 V68 H69 I80 H83 T98 C100 C105 H106

Gene Ontology

	Molecular Function
GO:0009055	electron transfer activity
GO:0020037	heme binding
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:1i77, PDBe:1i77, PDBj:1i77
PDBsum	1i77
PubMed	11358521
UniProt	Q9L915

[Back to BioLiP]