Structure of PDB 1i5z Chain A

Receptor sequence
>1i5zA (length=201) Species: 562 (Escherichia coli) [Search protein sequence]
QTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEE
GKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQL
IQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPD
AMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
Y
3D structure
PDB1i5z Structure of a Complex of Catabolite Gene Activator Protein and Cyclic AMP at 2.5 A Resolution
ChainA
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CMP A V49 G71 E72 L73 R82 S83 V86 R123 V44 G66 E67 L68 R77 S78 V81 R118
BS02 CMP A K57 E58 Q170 G173 Q174 G177 C178 S179 R180 K52 E53 Q165 G168 Q169 G172 C173 S174 R175
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003680 minor groove of adenine-thymine-rich DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0008301 DNA binding, bending
GO:0030552 cAMP binding
GO:0042802 identical protein binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0045013 carbon catabolite repression of transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1i5z, PDBe:1i5z, PDBj:1i5z
PDBsum1i5z
PubMed
UniProtP0ACJ8|CRP_ECOLI DNA-binding transcriptional dual regulator CRP (Gene Name=crp)

[Back to BioLiP]