Structure of PDB 1i55 Chain A

Receptor sequence

>1i55A (length=103) Species: 8237 (Thunnus thynnus)

GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTD
ANKSKGIVWNNDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKS
ATS

3D structure

• PDB: 1i55 Electron tunneling in protein crystals.
• Chain: A
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	C14 C17 H18 G29 P30 G41 Y48 T49 N52 W59 Y67 L68 T78 K79 M80 F82	C14 C17 H18 G29 P30 G41 Y48 T49 N52 W59 Y67 L68 T78 K79 M80 F82
BS02	ZNH	A	C14 C17 H18 G29 P30 G41 Y48 T49 N52 W59 L68 T78 K79 M80 F82	C14 C17 H18 G29 P30 G41 Y48 T49 N52 W59 L68 T78 K79 M80 F82

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
• GO:0043280 positive regulation of cysteine-type endopeptidase activity involved in apoptotic process

Cellular Component

• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:1i55, PDBe:1i55, PDBj:1i55
• PDBsum: 1i55
• PubMed: 11296248
• UniProt: P81459|CYC_THUAA Cytochrome c (Gene Name=cyc)