Structure of PDB 1i51 Chain A |
>1i51A (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] |
YQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFD VIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVT PIKDLTAHFRGARCKTLLEKPKLFFIQACRGTELDDGIQ |
|
PDB | 1i51 Structural basis of caspase-7 inhibition by XIAP. |
Chain | A |
Resolution | 2.45 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
M84 H144 T189 |
M27 H87 T132 |
|
|
|
|