Structure of PDB 1i3j Chain A

Receptor sequence

>1i3jA (length=96) Species: 10665 (Tequatrovirus T4)

KFCKCGVRIQTSAYTCSKCRNRSGENNSFFNHKHSDITKSKISEKMKGKK
PSNIKKISCDGVIFDCAADAARHFKISSGLVTYRVKSDKWNWFYIN

3D structure

• PDB: 1i3j Intertwined structure of the DNA-binding domain of intron endonuclease I-TevI with its substrate.
• Chain: A
• Resolution: 2.2 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	R170 S171 G172 N175 F177 N179 H180 H182 K187 S191 M194 K195 G196 P199 N201 I202 K203 C214 A215 A216 R220 T230 Y242	R22 S23 G24 N27 F29 N31 H32 H34 K39 S43 M46 K47 G48 P51 N53 I54 K55 C66 A67 A68 R72 T82 Y94
BS02	dna	A	A161 Y162 C164 S165 R168 S176 F177 H182 K193 P199 S200 S225 L228 Y231 K237	A13 Y14 C16 S17 R20 S28 F29 H34 K45 P51 S52 S77 L80 Y83 K89
BS03	ZN	A	C151 C153 C164 C167	C3 C5 C16 C19

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004519 endonuclease activity

External links

• PDB: RCSB:1i3j, PDBe:1i3j, PDBj:1i3j
• PDBsum: 1i3j
• PubMed: 11447104
• UniProt: P13299|TEV1_BPT4 Intron-associated endonuclease 1 (Gene Name=ITEVIR)