Structure of PDB 1i3e Chain A

Receptor sequence
>1i3eA (length=146) Species: 9606 (Homo sapiens) [Search protein sequence]
GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSS
ASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDP
ENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH
3D structure
PDB1i3e Oligomerization and ligand binding in a homotetrameric hemoglobin: two high-resolution crystal structures of hemoglobin Bart's (gamma(4)), a marker for alpha-thalassemia.
ChainA
Resolution1.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 AZI A H63 V67 H63 V67
BS02 HEM A F41 F42 H63 S70 L88 H92 L96 V98 N102 F103 L106 L141 F41 F42 H63 S70 L88 H92 L96 V98 N102 F103 L106 L141
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0031720 haptoglobin binding
GO:0031721 hemoglobin alpha binding
GO:0043177 organic acid binding
GO:0046872 metal ion binding
Biological Process
GO:0015670 carbon dioxide transport
GO:0015671 oxygen transport
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005829 cytosol
GO:0005833 hemoglobin complex
GO:0031838 haptoglobin-hemoglobin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1i3e, PDBe:1i3e, PDBj:1i3e
PDBsum1i3e
PubMed11514664
UniProtP69891|HBG1_HUMAN Hemoglobin subunit gamma-1 (Gene Name=HBG1)

[Back to BioLiP]