Structure of PDB 1hyf Chain A

Receptor sequence

>1hyfA (length=104) Species: 5062 (Aspergillus oryzae)

ACDYTCGSNCYSSSDASTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDF
SVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNF
VECT

3D structure

• PDB: 1hyf The contribution of metal ions to the conformational stability of ribonuclease T1: crystal versus solution.
• Chain: A
• Resolution: 1.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y38 H40 E58 D76 R77 T91 H92 F100
• Catalytic site (residue number reindexed from 1): Y38 H40 E58 D76 R77 T91 H92 F100
• Enzyme Commision number: 4.6.1.24: ribonuclease T1.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	2GP	A	Y38 H40 Y42 N43 N44 Y45 E46 E58 N98 F100	Y38 H40 Y42 N43 N44 Y45 E46 E58 N98 F100

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0004519 endonuclease activity
• GO:0004521 RNA endonuclease activity
• GO:0004540 RNA nuclease activity
• GO:0016829 lyase activity
• GO:0046589 ribonuclease T1 activity

Biological Process

• GO:0008150 biological_process

Cellular Component

• GO:0001411 hyphal tip
• GO:0030428 cell septum

External links

• PDB: RCSB:1hyf, PDBe:1hyf, PDBj:1hyf
• PDBsum: 1hyf
• PubMed: 11453993
• UniProt: P00651|RNT1_ASPOR Guanyl-specific ribonuclease T1 (Gene Name=rntA)