Structure of PDB 1hvf Chain A

Receptor sequence
>1hvfA (length=313) Species: 9606 (Homo sapiens) [Search protein sequence]
VLRGTVTDFPGFDGRADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEI
SAAFKTLFGRDLLDDLKSELTGKFQKLIVALMKPSRLYDAYELKHALKGA
GTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRML
VVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSV
SHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAE
TLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGD
TSGDYKKALLLLC
3D structure
PDB1hvf Structural and electrophysiological analysis of annexin V mutants. Mutagenesis of human annexin V, an in vitro voltage-gated calcium channel, provides information about the structural features of the ion pathway, the voltage sensor and the ion selectivity filter
ChainA
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A L100 G102 G104 D144 L97 G99 G101 D141
BS02 CA A M259 G261 G263 D303 M256 G258 G260 D300
BS03 CA A M28 G30 G32 E72 M25 G27 G29 E69
BS04 CA A T33 E35 T30 E32
BS05 CA A T33 E72 T30 E69
Gene Ontology
Molecular Function
GO:0001786 phosphatidylserine binding
GO:0004859 phospholipase inhibitor activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0005543 phospholipid binding
GO:0005544 calcium-dependent phospholipid binding
Biological Process
GO:0007165 signal transduction
GO:0007596 blood coagulation
GO:0043066 negative regulation of apoptotic process
GO:0050819 negative regulation of coagulation
Cellular Component
GO:0005576 extracellular region
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005925 focal adhesion
GO:0009897 external side of plasma membrane
GO:0012506 vesicle membrane
GO:0016020 membrane
GO:0042383 sarcolemma
GO:0062023 collagen-containing extracellular matrix
GO:0070062 extracellular exosome
GO:0072563 endothelial microparticle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1hvf, PDBe:1hvf, PDBj:1hvf
PDBsum1hvf
PubMed8151707
UniProtP08758|ANXA5_HUMAN Annexin A5 (Gene Name=ANXA5)

[Back to BioLiP]