Structure of PDB 1hvb Chain A

Receptor sequence

>1hvbA (length=346) Species: 31952 (Streptomyces sp. R61)

DLPAPDDTGLQAVLHTALSQGAPGAMVRVDDNGTIHQLSEGVADRATGRA
ITTTDRFRVGSVTKSFSAVVLLQLVDEGKLDLDASVNTYLPGLLPDDRIT
VRQVMSHRSGLYDYTNDMFAQTVPGFESVRNKVFSYQDLITLSLKHGVTN
APGAAYSYSNTNFVVAGMLIEKLTGHSVATEYQNRIFTPLNLTDTFYVHP
DTVIPGTHANGYLTPDEAGGALVDSTEQTVSWAQSAGAVISSTQDLDTFF
SALMSGQLMSAAQLAQMQQWTTVNSTQGYGLGLRRRDLSCGISVYGHTGT
VQGYYTYAFASKDGKRSVTALANTSNNVNVLNTMARTLESAFCGKP

3D structure

• PDB: 1hvb A 1.2-A snapshot of the final step of bacterial cell wall biosynthesis.
• Chain: A
• Resolution: 1.17 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S62 K65 D114 T116 V130 Y159 N161 V165 T227 H298 G304
• Catalytic site (residue number reindexed from 1): S61 K64 D113 T115 V129 Y158 N160 V164 T226 H297 G303
• Enzyme Commision number: 3.4.16.4: serine-type D-Ala-D-Ala carboxypeptidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CEH	A	S62 F120 Y159 N161 W233 N275 T299 G300 T301 Y306 N327	S61 F119 Y158 N160 W232 N274 T298 G299 T300 Y305 N326

Gene Ontology

Molecular Function

• GO:0004180 carboxypeptidase activity
• GO:0009002 serine-type D-Ala-D-Ala carboxypeptidase activity

Biological Process

• GO:0006508 proteolysis
• GO:0008360 regulation of cell shape
• GO:0009252 peptidoglycan biosynthetic process
• GO:0071555 cell wall organization

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:1hvb, PDBe:1hvb, PDBj:1hvb
• PDBsum: 1hvb
• PubMed: 11171967
• UniProt: P15555|DAC_STRSR D-alanyl-D-alanine carboxypeptidase