Structure of PDB 1hv2 Chain A

Receptor sequence
>1hv2A (length=99) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MSQDFVTLVSKDDKEYEISRSAAMISPTLKAMIEGPFRESKGRIELKQFD
SHILEKAVEYLNYNLKYSGVSEDDDEIPEFEIPTEMSLELLLAADYLSI
3D structure
PDB1hv2 Solution structure and dynamics of yeast elongin C in complex with a von Hippel-Lindau peptide.
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A Y60 F80 I82 T84 S87 L91 A94 D95 Y60 F80 I82 T84 S87 L91 A94 D95
Gene Ontology
Molecular Function
GO:0004842 ubiquitin-protein transferase activity
GO:0005515 protein binding
GO:0030674 protein-macromolecule adaptor activity
Biological Process
GO:0006289 nucleotide-excision repair
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0009411 response to UV
GO:0070911 global genome nucleotide-excision repair
Cellular Component
GO:0000113 nucleotide-excision repair factor 4 complex
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0031463 Cul3-RING ubiquitin ligase complex
GO:0070449 elongin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1hv2, PDBe:1hv2, PDBj:1hv2
PDBsum1hv2
PubMed11545595
UniProtQ03071|ELOC_YEAST Elongin-C (Gene Name=ELC1)

[Back to BioLiP]