Structure of PDB 1htb Chain A

Receptor sequence

>1htbA (length=374) Species: 9606 (Homo sapiens) [Search protein sequence]

STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICRTDD
HVVSGNLVTPLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKC
RVCKNPESNYCLKNDLGNPRGTLQDGTRRFTCRGKPIHHFLGTSTFSQYT
VVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGL
GGVGLSAVMGCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPI
QEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPASQN
LSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVL
PFEKINEGFDLLHSGKSICTVLTF

3D structure

PDB

1htb X-ray structure of human beta3beta3 alcohol dehydrogenase. The contribution of ionic interactions to coenzyme binding.

Chain

Resolution

2.4 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	C46 R47 T48 H51 H67 E68 C97 C100 C103 C111 D115 C174 T178 C369
Catalytic site (residue number reindexed from 1)	C46 R47 T48 H51 H67 E68 C97 C100 C103 C111 D115 C174 T178 C369
Enzyme Commision number	1.1.1.105: all-trans-retinol dehydrogenase (NAD(+)).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	ZN	A	C97 C100 C103 C111	C97 C100 C103 C111
BS02	ZN	A	C46 H67 C174	C46 H67 C174
BS03	NAD	A	C46 R47 T48 H51 C174 T178 G201 V203 D223 I224 K228 V268 I269 V292 G293 V294 L362	C46 R47 T48 H51 C174 T178 G201 V203 D223 I224 K228 V268 I269 V292 G293 V294 L362
BS04	PYZ	A	T48 H67 F93 L116 C174	T48 H67 F93 L116 C174

Gene Ontology

	Molecular Function
GO:0004022	alcohol dehydrogenase (NAD+) activity
GO:0004745	all-trans-retinol dehydrogenase (NAD+) activity
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0016491	oxidoreductase activity
GO:0046872	metal ion binding

	Biological Process
GO:0001523	retinoid metabolic process
GO:0006629	lipid metabolic process
GO:0042572	retinol metabolic process
GO:0042573	retinoic acid metabolic process

	Cellular Component
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005886	plasma membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1htb, PDBe:1htb, PDBj:1htb
PDBsum	1htb
PubMed	8663387
UniProt	P00325\|ADH1B_HUMAN All-trans-retinol dehydrogenase [NAD(+)] ADH1B (Gene Name=ADH1B)

[Back to BioLiP]