Structure of PDB 1hqv Chain A

Receptor sequence
>1hqvA (length=178) Species: 10090 (Mus musculus) [Search protein sequence]
PGPGGGPGPAALPDQSFLWNVFQRVDKDRSGVISDNELQQALSNGTWTPF
NPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMI
DKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQR
LTDIFRRYDTDQDGWIQVSYEQYLSMVF
3D structure
PDB1hqv Structure of apoptosis-linked protein ALG-2: insights into Ca2+-induced changes in penta-EF-hand proteins.
ChainA
Resolution2.3 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) F85 G108 I110
Catalytic site (residue number reindexed from 1) F75 G98 I100
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A D36 D38 S40 V42 E47 D26 D28 S30 V32 E37
BS02 CA A D103 D105 S107 M109 E114 D93 D95 S97 M99 E104
BS03 CA A D169 D171 D173 W175 D159 D161 D163 W165
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0030674 protein-macromolecule adaptor activity
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0043495 protein-membrane adaptor activity
GO:0046872 metal ion binding
GO:0046982 protein heterodimerization activity
GO:0046983 protein dimerization activity
GO:0048306 calcium-dependent protein binding
GO:1990756 ubiquitin-like ligase-substrate adaptor activity
Biological Process
GO:0001525 angiogenesis
GO:0001938 positive regulation of endothelial cell proliferation
GO:0006886 intracellular protein transport
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006915 apoptotic process
GO:0010595 positive regulation of endothelial cell migration
GO:0014029 neural crest formation
GO:0014032 neural crest cell development
GO:0030948 negative regulation of vascular endothelial growth factor receptor signaling pathway
GO:0032007 negative regulation of TOR signaling
GO:0034605 cellular response to heat
GO:0036324 vascular endothelial growth factor receptor-2 signaling pathway
GO:0043280 positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0045766 positive regulation of angiogenesis
GO:0048208 COPII vesicle coating
GO:0051592 response to calcium ion
GO:0051898 negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:1902527 positive regulation of protein monoubiquitination
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0012507 ER to Golgi transport vesicle membrane
GO:0016020 membrane
GO:0030127 COPII vesicle coat
GO:0031410 cytoplasmic vesicle
GO:0031463 Cul3-RING ubiquitin ligase complex
GO:0048471 perinuclear region of cytoplasm
GO:0070971 endoplasmic reticulum exit site

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1hqv, PDBe:1hqv, PDBj:1hqv
PDBsum1hqv
PubMed11525164
UniProtP12815|PDCD6_MOUSE Programmed cell death protein 6 (Gene Name=Pdcd6)

[Back to BioLiP]