Structure of PDB 1hpo Chain A |
>1hpoA (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGI GGFIKVRQYDQIIIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
|
PDB | 1hpo Structure-based design of nonpeptidic HIV protease inhibitors: the sulfonamide-substituted cyclooctylpyramones. |
Chain | A |
Resolution | 2.5 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
UNI |
A |
R8 D25 G27 G49 |
R8 D25 G27 G49 |
PDBbind-CN: -logKd/Ki=9.22,Ki=0.6nM |
|
|
|