Structure of PDB 1hmr Chain A

Receptor sequence

>1hmrA (length=131) Species: 9606 (Homo sapiens)

VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILT
LKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQ
ETTLVRELIDGKLILTLTHGTAVCTRTYEKE

3D structure

• PDB: 1hmr Structural studies on human muscle fatty acid binding protein at 1.4 A resolution: binding interactions with three C18 fatty acids.
• Chain: A
• Resolution: 1.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ELA	A	K58 D76 L115 R126 Y128	K58 D76 L115 R126 Y128	MOAD: Kd=0.28uM PDBbind-CN: -logKd/Ki=6.55,Kd=0.28uM

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008092 cytoskeletal protein binding
• GO:0008289 lipid binding
• GO:0036041 long-chain fatty acid binding
• GO:0070538 oleic acid binding

Biological Process

• GO:0008285 negative regulation of cell population proliferation
• GO:0015909 long-chain fatty acid transport
• GO:0032365 intracellular lipid transport
• GO:0042632 cholesterol homeostasis
• GO:0046320 regulation of fatty acid oxidation
• GO:0050873 brown fat cell differentiation
• GO:0055091 phospholipid homeostasis
• GO:0071073 positive regulation of phospholipid biosynthetic process
• GO:0140214 positive regulation of long-chain fatty acid import into cell
• GO:2001245 regulation of phosphatidylcholine biosynthetic process

Cellular Component

• GO:0005615 extracellular space
• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:1hmr, PDBe:1hmr, PDBj:1hmr
• PDBsum: 1hmr
• PubMed: 7922029
• UniProt: P05413|FABPH_HUMAN Fatty acid-binding protein, heart (Gene Name=FABP3)