Structure of PDB 1hlv Chain A

Receptor sequence

>1hlvA (length=131) Species: 9606 (Homo sapiens)

MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKR
AILASERKYGVASTCRKTNKLSPYDKLEGLLIAWFQQIRAAGLPVKGIIL
KEKALRIAEELGMDDFTASNGWLDRFRRRRS

3D structure

• PDB: 1hlv Crystal structure of the CENP-B protein-DNA complex: the DNA-binding domains of CENP-B induce kinks in the CENP-B box DNA.
• Chain: A
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	P3 R5 R27 K28 G29 S43 K47 R66 T68 K70 S72 P73 Y74 S119 N120 G121 W122 R125 R129	P3 R5 R27 K28 G29 S43 K47 R66 T68 K70 S72 P73 Y74 S119 N120 G121 W122 R125 R129
BS02	dna	A	R5 R6 K13 P38 S40 T41 T44 T68 N69 K70 G97 N120 R127	R5 R6 K13 P38 S40 T41 T44 T68 N69 K70 G97 N120 R127

Gene Ontology

Molecular Function

• GO:0003677 DNA binding

External links

• PDB: RCSB:1hlv, PDBe:1hlv, PDBj:1hlv
• PDBsum: 1hlv
• PubMed: 11726497
• UniProt: P07199|CENPB_HUMAN Major centromere autoantigen B (Gene Name=CENPB)