Structure of PDB 1hf0 Chain A

Receptor sequence
>1hf0A (length=128) Species: 9606 (Homo sapiens) [Search protein sequence]
LEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNL
SFKNMSKLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPTSEEI
TMIADQLNMEKEVIRVWFSNRRQKEKRI
3D structure
PDB1hf0 Differential Dimer Activities of the Transcription Factor Oct-1 by DNA-Induced Interface Swapping
ChainA
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R20 T26 Q27 Q44 S48 R102 K103 R105 T106 V147 N151 K155 R15 T21 Q22 Q39 S43 R71 K72 R74 T75 V116 N120 K124
BS02 dna A S43 T45 T46 R49 S56 N59 R102 R105 R153 Q154 K157 S38 T40 T41 R44 S51 N54 R71 R74 R122 Q123 K126
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1hf0, PDBe:1hf0, PDBj:1hf0
PDBsum1hf0
PubMed11583619
UniProtP14859|PO2F1_HUMAN POU domain, class 2, transcription factor 1 (Gene Name=POU2F1)

[Back to BioLiP]