Structure of PDB 1hc8 Chain A

Receptor sequence
>1hc8A (length=74) Species: 1422 (Geobacillus stearothermophilus) [Search protein sequence]
TFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDL
NAASIEAAMRMIEGTARSMGIVVE
3D structure
PDB1hc8 A Compact RNA Tertiary Structure Contains a Buried Backbone-K+ Complex
ChainA
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A P9 A10 K15 S22 G23 S24 G25 E26 P27 N28 R29 K47 L51 N52 A54 A58 R61 M62 G65 T66 R68 S69 M70 P8 A9 K14 S21 G22 S23 G24 E25 P26 N27 R28 K46 L50 N51 A53 A57 R60 M61 G64 T65 R67 S68 M69
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1hc8, PDBe:1hc8, PDBj:1hc8
PDBsum1hc8
PubMed12054794
UniProtP56210|RL11_GEOSE Large ribosomal subunit protein uL11 (Fragment) (Gene Name=rplK)

[Back to BioLiP]