Structure of PDB 1hbx Chain A

Receptor sequence
>1hbxA (length=87) Species: 9606 (Homo sapiens) [Search protein sequence]
GKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLL
VASETGHVYTFATRKLQPMITSETGKALIQTCLNSPD
3D structure
PDB1hbx The B-Box Dominates Sap-1/Srf Interactions in the Structure of the Ternary Complex
ChainA
Resolution3.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A G142 R143 V144 R156 T160 K163 R164 K170 G6 R7 V8 R20 T24 K27 R28 K34
BS02 dna A K138 K139 T140 R141 G142 R143 K145 Y158 K171 Y195 K2 K3 T4 R5 G6 R7 K9 Y22 K35 Y59
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987 cis-regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1hbx, PDBe:1hbx, PDBj:1hbx
PDBsum1hbx
PubMed11406578
UniProtP11831|SRF_HUMAN Serum response factor (Gene Name=SRF)

[Back to BioLiP]