Structure of PDB 1h9t Chain A

Receptor sequence
>1h9tA (length=232) Species: 562 (Escherichia coli) [Search protein sequence]
AQSPAGFAEEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQR
LARDGWLTIQHGKPTKVNNFWETSGLNILETLARLDHESVPQLIDNLLSV
RTNISTIFIRTAFRQHPDKAQEVLATANEVADHADAFAELDYNIFRGLAF
ASGNPIYGLILNGMKGLYTRIGRHYFANPEARSLALGFYHKLSALCSEGA
HDQVYETVRRYGHESGEIWHRMQKNLLAIQGR
3D structure
PDB1h9t The Structural Basis of Acyl Coenzyme A-Dependent Regulation of the Transcription Factor Fadr
ChainA
Resolution3.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A S7 A9 T44 T47 H65 G66 S3 A5 T40 T43 H61 G62 PDBbind-CN: Kd=0.2nM
BS02 dna A A33 E34 R35 R45 R49 I63 Q64 H65 G66 K67 A29 E30 R31 R41 R45 I59 Q60 H61 G62 K63 PDBbind-CN: Kd=0.2nM
Gene Ontology
Molecular Function
GO:0000062 fatty-acyl-CoA binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0042803 protein homodimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006631 fatty acid metabolic process
GO:0019217 regulation of fatty acid metabolic process
GO:0045723 positive regulation of fatty acid biosynthetic process
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1h9t, PDBe:1h9t, PDBj:1h9t
PDBsum1h9t
PubMed11296236
UniProtP0A8V6|FADR_ECOLI Fatty acid metabolism regulator protein (Gene Name=fadR)

[Back to BioLiP]