Structure of PDB 1h53 Chain A

Receptor sequence
>1h53A (length=121) Species: 9606 (Homo sapiens) [Search protein sequence]
NSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRS
IKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRN
VVVACENGLPVHLDGSIFRRP
3D structure
PDB1h53 Binding of Phosphate and Pyrophosphate Ions at the Active Site of Human Angiogenin as Revealed by X-Ray Crystallography
ChainA
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H13 K40 H114 L115 D116
Catalytic site (residue number reindexed from 1) H11 K38 H112 L113 D114
Enzyme Commision number 3.1.27.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PO4 A Q12 H13 H114 L115 Q10 H11 H112 L113
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003779 actin binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0004540 RNA nuclease activity
GO:0004549 tRNA-specific ribonuclease activity
GO:0005102 signaling receptor binding
GO:0005507 copper ion binding
GO:0005515 protein binding
GO:0008201 heparin binding
GO:0019843 rRNA binding
GO:0042277 peptide binding
GO:0042803 protein homodimerization activity
GO:0043022 ribosome binding
Biological Process
GO:0001525 angiogenesis
GO:0001541 ovarian follicle development
GO:0001556 oocyte maturation
GO:0001666 response to hypoxia
GO:0001890 placenta development
GO:0001938 positive regulation of endothelial cell proliferation
GO:0007154 cell communication
GO:0009303 rRNA transcription
GO:0009725 response to hormone
GO:0016078 tRNA decay
GO:0016477 cell migration
GO:0017148 negative regulation of translation
GO:0019731 antibacterial humoral response
GO:0023052 signaling
GO:0030041 actin filament polymerization
GO:0030154 cell differentiation
GO:0032055 negative regulation of translation in response to stress
GO:0034063 stress granule assembly
GO:0042327 positive regulation of phosphorylation
GO:0042592 homeostatic process
GO:0043066 negative regulation of apoptotic process
GO:0045087 innate immune response
GO:0048662 negative regulation of smooth muscle cell proliferation
GO:0050714 positive regulation of protein secretion
GO:0050830 defense response to Gram-positive bacterium
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0071425 hematopoietic stem cell proliferation
Cellular Component
GO:0005576 extracellular region
GO:0005604 basement membrane
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0010494 cytoplasmic stress granule
GO:0015629 actin cytoskeleton
GO:0030139 endocytic vesicle
GO:0030426 growth cone
GO:0031410 cytoplasmic vesicle
GO:0032311 angiogenin-PRI complex
GO:0043025 neuronal cell body

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1h53, PDBe:1h53, PDBj:1h53
PDBsum1h53
PubMed11468363
UniProtP03950|ANGI_HUMAN Angiogenin (Gene Name=ANG)

[Back to BioLiP]