Structure of PDB 1h2l Chain A

Receptor sequence

>1h2lA (length=332) Species: 9606 (Homo sapiens) [Search protein sequence]

EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVL
TDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNF
KPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLG
FNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYK
RCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETV
VGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVA
IMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN

3D structure

PDB

1h2l Structure of Factor-Inhibiting Hypoxia-Inducible Factor (Hif) Reveals Mechanism of Oxidative Modification of Hif-1Alpha

Chain

Resolution

2.25 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.14.11.30: hypoxia-inducible factor-asparagine dioxygenase.
1.14.11.n4: ankyrin-repeat-histidine dioxagenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	Y102 T149 N151 D152 F162 W167 Q181 L182 T183 S184 H199 D201 E202 Q203 R238 Q239 M275 Y276 W296 G299 A300 T302 N321	Y88 T135 N137 D138 F148 W153 Q167 L168 T169 S170 H185 D187 E188 Q189 R224 Q225 M261 Y262 W282 G285 A286 T288 N304
BS02	FE2	A	H199 D201 H279	H185 D187 H265
BS03	AKG	A	Y145 T196 H199 N205 F207 K214 H279 I281 W296	Y131 T182 H185 N191 F193 K200 H265 I267 W282

Gene Ontology

	Molecular Function
GO:0003714	transcription corepressor activity
GO:0005112	Notch binding
GO:0005515	protein binding
GO:0008198	ferrous iron binding
GO:0008270	zinc ion binding
GO:0019826	oxygen sensor activity
GO:0031406	carboxylic acid binding
GO:0036139	peptidyl-histidine dioxygenase activity
GO:0036140	[protein]-asparagine 3-dioxygenase activity
GO:0042803	protein homodimerization activity
GO:0046872	metal ion binding
GO:0051059	NF-kappaB binding
GO:0051213	dioxygenase activity
GO:0062101	peptidyl-aspartic acid 3-dioxygenase activity
GO:0071532	ankyrin repeat binding

	Biological Process
GO:0045663	positive regulation of myoblast differentiation
GO:0045746	negative regulation of Notch signaling pathway
GO:0045892	negative regulation of DNA-templated transcription
GO:2001214	positive regulation of vasculogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0048471	perinuclear region of cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1h2l, PDBe:1h2l, PDBj:1h2l
PDBsum	1h2l
PubMed	12446723
UniProt	Q9NWT6\|HIF1N_HUMAN Hypoxia-inducible factor 1-alpha inhibitor (Gene Name=HIF1AN)

[Back to BioLiP]