Structure of PDB 1gyo Chain A

Receptor sequence

>1gyoA (length=106) Species: 879 (Megalodesulfovibrio gigas) [Search protein sequence]

LDVPCKVVITAPEGEDPHPRFGKVEMSHAKHRNVSCVSCHHMFDGCGDFQ
KCADCHIDRDDRSYERGFYKAWHSESEISCRGCHKAMKAKNEQTGPIGCL
QGCHEA

3D structure

PDB

1gyo Structure of Dimeric Cytochrome C3 from Desulfovibrio Gigas at 1.2 A Resolution

Chain

Resolution

1.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEC	A	V3 M26 H28 H31 V34 C36 C39 H40 F49 K51 C52	V3 M26 H28 H31 V34 C36 C39 H40 F49 K51 C52
BS02	HEC	A	C39 H41 M42 Q50 C52 C55 H56 E65 K70 A71 S74 I78 S79	C39 H41 M42 Q50 C52 C55 H56 E65 K70 A71 S74 I78 S79
BS03	HEC	A	M26 K30 H31 C80 C83 H84 M87 Q93 T94 G95 P96	M26 K30 H31 C80 C83 H84 M87 Q93 T94 G95 P96
BS04	HEC	A	I9 H18 F21 G22 K23 V24 R59 F68 Y69 W72 H73 C80 R81 H84 P96 I97 C99 C103 H104	I9 H18 F21 G22 K23 V24 R59 F68 Y69 W72 H73 C80 R81 H84 P96 I97 C99 C103 H104

Gene Ontology

External links