Structure of PDB 1gy1 Chain A |
>1gy1A (length=154) Species: 920 (Acidithiobacillus ferrooxidans) [Search protein sequence] |
TLDTTWKEATLPQVKAMLQKDTGKVSGDTVTYSGKTVHVVAAAVLPGFPF PSFEVHDKKNPTLQIPAGATVDVTFINTNKGFGHDFDITKKGPPYAVMPV IDPIVAGTGFSPVPKDGKFGYTNFTWHPTAGTYYYVCQIPGHAATGMFGK IVVK |
|
PDB | 1gy1 Crystal Structures of the met148Leu and Ser86Asp Mutants of Rusticyanin from Thiobacillus Ferrooxidans: Insights Into the Structural Relationship with the Cupredoxins and the Multi Copper Proteins |
Chain | A |
Resolution | 1.65 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H85 C138 H143 |
H84 C137 H142 |
|
|
|
|