Structure of PDB 1gxd Chain A

Receptor sequence
>1gxdA (length=624) Species: 9606 (Homo sapiens) [Search protein sequence]
APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQK
FFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRII
GYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHG
DGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNAD
GEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEAL
FTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKY
GFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTA
NYDDDRKWGFCPDQGYSLFLVAAHAFGHAMGLEHSQDPGALMAPIYTYTK
NFRLSQDDIKGIQELYGASPDTPTLGPVTPEICKQDIVFDGIAQIRGEIF
FFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFA
GNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGD
KFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAY
YLKLENQSLKSVKFGSIKSDWLGC
3D structure
PDB1gxd Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
ChainA
Resolution3.1 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H374 A375 H378 H384
Catalytic site (residue number reindexed from 1) H374 A375 H378 H384
Enzyme Commision number 3.4.24.24: gelatinase A.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A H149 D151 H164 H177 H149 D151 H164 H177
BS02 ZN A C73 H374 H378 H384 C73 H374 H378 H384
BS03 CA A D156 G157 D159 L161 D179 E182 D156 G157 D159 L161 D179 E182
Gene Ontology
Molecular Function
GO:0001968 fibronectin binding
GO:0004175 endopeptidase activity
GO:0004222 metalloendopeptidase activity
GO:0004252 serine-type endopeptidase activity
GO:0005515 protein binding
GO:0008233 peptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0001525 angiogenesis
GO:0001541 ovarian follicle development
GO:0001542 ovulation from ovarian follicle
GO:0001553 luteinization
GO:0001666 response to hypoxia
GO:0001955 blood vessel maturation
GO:0001957 intramembranous ossification
GO:0006508 proteolysis
GO:0006979 response to oxidative stress
GO:0007162 negative regulation of cell adhesion
GO:0007507 heart development
GO:0007565 female pregnancy
GO:0007566 embryo implantation
GO:0007567 parturition
GO:0009410 response to xenobiotic stimulus
GO:0009612 response to mechanical stimulus
GO:0014012 peripheral nervous system axon regeneration
GO:0014823 response to activity
GO:0016477 cell migration
GO:0022617 extracellular matrix disassembly
GO:0030163 protein catabolic process
GO:0030198 extracellular matrix organization
GO:0030335 positive regulation of cell migration
GO:0030574 collagen catabolic process
GO:0032526 response to retinoic acid
GO:0034097 response to cytokine
GO:0034614 cellular response to reactive oxygen species
GO:0035094 response to nicotine
GO:0035987 endodermal cell differentiation
GO:0042542 response to hydrogen peroxide
GO:0043065 positive regulation of apoptotic process
GO:0043627 response to estrogen
GO:0045906 negative regulation of vasoconstriction
GO:0048013 ephrin receptor signaling pathway
GO:0048246 macrophage chemotaxis
GO:0048661 positive regulation of smooth muscle cell proliferation
GO:0048705 skeletal system morphogenesis
GO:0048771 tissue remodeling
GO:0051602 response to electrical stimulus
GO:0055093 response to hyperoxia
GO:0060325 face morphogenesis
GO:0060346 bone trabecula formation
GO:0060740 prostate gland epithelium morphogenesis
GO:0071230 cellular response to amino acid stimulus
GO:0071345 cellular response to cytokine stimulus
GO:0071347 cellular response to interleukin-1
GO:0071392 cellular response to estradiol stimulus
GO:0071492 cellular response to UV-A
GO:0071498 cellular response to fluid shear stress
GO:1903378 positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway
GO:1904645 response to amyloid-beta
GO:1904707 positive regulation of vascular associated smooth muscle cell proliferation
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030017 sarcomere
GO:0031012 extracellular matrix
GO:0062023 collagen-containing extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1gxd, PDBe:1gxd, PDBj:1gxd
PDBsum1gxd
PubMed12032297
UniProtP08253|MMP2_HUMAN 72 kDa type IV collagenase (Gene Name=MMP2)

[Back to BioLiP]