Structure of PDB 1grx Chain A

Receptor sequence
>1grxA (length=85) Species: 562 (Escherichia coli) [Search protein sequence]
MQTVIFGRSGCPYSVRAKDLAEKLSNERDDFQYQYVDIRAEGITKEDLQQ
KAGKPVETVPQIFVDQQHIGGYTDFAAWVKENLDA
3D structure
PDB1grx NMR structure of oxidized Escherichia coli glutaredoxin: comparison with reduced E. coli glutaredoxin and functionally related proteins.
ChainA
ResolutionN/A
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) R8 G10 C11 Y13 S14 K18 Y72
Catalytic site (residue number reindexed from 1) R8 G10 C11 Y13 S14 K18 Y72
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GSH A C11 Y13 S14 T58 V59 C11 Y13 S14 T58 V59
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0009055 electron transfer activity
GO:0015035 protein-disulfide reductase activity
GO:0015036 disulfide oxidoreductase activity
GO:0015038 glutathione disulfide oxidoreductase activity
GO:0019153 protein-disulfide reductase (glutathione) activity
Biological Process
GO:0009263 deoxyribonucleotide biosynthetic process
GO:0010134 sulfate assimilation via adenylyl sulfate reduction
GO:0019345 cysteine biosynthetic process via S-sulfo-L-cysteine
GO:0034599 cellular response to oxidative stress
GO:0045454 cell redox homeostasis
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1grx, PDBe:1grx, PDBj:1grx
PDBsum1grx
PubMed1304339
UniProtP68688|GLRX1_ECOLI Glutaredoxin 1 (Gene Name=grxA)

[Back to BioLiP]