Structure of PDB 1grb Chain A

Receptor sequence

>1grbA (length=461) Species: 9606 (Homo sapiens) [Search protein sequence]

VASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKK
VMWNTAVHSEFMHDHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNN
LTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMPSTPHESQ
IPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMI
RHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSMVT
AVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVDE
FQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNI
PTVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKC
VMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIH
PTSSEELVTLR

3D structure

PDB

1grb Substrate binding and catalysis by glutathione reductase as derived from refined enzyme: substrate crystal structures at 2 A resolution.

Chain

Resolution

1.85 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	L54 C58 C63 K66 Y197 E201 A465 H467 E472
Catalytic site (residue number reindexed from 1)	L37 C41 C46 K49 Y180 E184 A448 H450 E455
Enzyme Commision number	1.8.1.7: glutathione-disulfide reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	PO4	A	R218 H219 R224	R201 H202 R207
BS02	FAD	A	G29 G31 E50 S51 T57 G62 C63 K66 H129 A130 T156 G157 G330 D331 L337 L338 T339	G12 G14 E33 S34 T40 G45 C46 K49 H112 A113 T139 G140 G313 D314 L320 L321 T322
BS03	NAD	A	K66 A195 G196 Y197 I198 E201 R218 A288 I289 G290 L337 V370	K49 A178 G179 Y180 I181 E184 R201 A271 I272 G273 L320 V353
BS04	NDP	A	K66 A195 G196 Y197 I198 E201 R218 R224 I289 G290 L337 V370	K49 A178 G179 Y180 I181 E184 R201 R207 I272 G273 L320 V353

Gene Ontology

	Molecular Function
GO:0004362	glutathione-disulfide reductase (NADPH) activity
GO:0009055	electron transfer activity
GO:0016491	oxidoreductase activity
GO:0016668	oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor
GO:0050660	flavin adenine dinucleotide binding
GO:0050661	NADP binding

	Biological Process
GO:0006749	glutathione metabolic process
GO:0034599	cellular response to oxidative stress
GO:0045454	cell redox homeostasis
GO:0098869	cellular oxidant detoxification

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005759	mitochondrial matrix
GO:0005829	cytosol
GO:0009897	external side of plasma membrane
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1grb, PDBe:1grb, PDBj:1grb
PDBsum	1grb
PubMed	2585516
UniProt	P00390\|GSHR_HUMAN Glutathione reductase, mitochondrial (Gene Name=GSR)

[Back to BioLiP]