Structure of PDB 1gnn Chain A

Receptor sequence

>1gnnA (length=99) Species: 11676 (Human immunodeficiency virus 1)

PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGI
GGFIKVRQYDQILIEICGHKAIGTVLVGPTPNNIIGRNLLTQIGCTLNF

3D structure

• PDB: 1gnn Crystal structures of complexes of a peptidic inhibitor with wild-type and two mutant HIV-1 proteases.
• Chain: A
• Resolution: 2.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D25 T26 G27
• Catalytic site (residue number reindexed from 1): D25 T26 G27
• Enzyme Commision number: 2.7.7.-
  2.7.7.49: RNA-directed DNA polymerase.
  2.7.7.7: DNA-directed DNA polymerase.
  3.1.-.-
  3.1.13.2: exoribonuclease H.
  3.1.26.13: retroviral ribonuclease H.
  3.4.23.16: HIV-1 retropepsin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	U0E	A	R8 D25 G27 G49 I50 N82 I84	R8 D25 G27 G49 I50 N82 I84	MOAD: Ki=2100nM PDBbind-CN: -logKd/Ki=5.68,Ki=2100nM
BS02	U0E	A	D25 G27 A28 D29 D30 I47 G48 G49 I50 P81 N82 I84	D25 G27 A28 D29 D30 I47 G48 G49 I50 P81 N82 I84	MOAD: Ki=2100nM PDBbind-CN: -logKd/Ki=5.68,Ki=2100nM

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:1gnn, PDBe:1gnn, PDBj:1gnn
• PDBsum: 1gnn
• PubMed: 8718851
• UniProt: P03366|POL_HV1B1 Gag-Pol polyprotein (Gene Name=gag-pol)