Structure of PDB 1gmw Chain A

Receptor sequence

>1gmwA (length=138)

MLYLTQRLEIPAAATASVTLPIDVRVKSRVKVTLNDGRDAGLLLPRGLLL
RGGDVLSNEEGTEFVQVIAADEEVSVVRCDDPFMLAKACYALGNRHVPLQ
IMPGELRYHHDHVLDDMLRQFGLTVTFGQLPFEPEAGA

3D structure

• PDB: 1gmw Crystal Structure of Klebsiella Aerogenes Uree, a Nickel-Binding Metallochaperone for Urease Activation
• Chain: A
• Resolution: 1.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CU	A	H110 H112	H110 H112

Gene Ontology

Molecular Function

• GO:0016151 nickel cation binding
• GO:0046872 metal ion binding
• GO:0051082 unfolded protein binding

Biological Process

• GO:0006457 protein folding
• GO:0019627 urea metabolic process
• GO:0065003 protein-containing complex assembly

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1gmw, PDBe:1gmw, PDBj:1gmw
• PDBsum: 1gmw
• PubMed: 11591723
• UniProt: P18317|UREE_KLEAE Urease accessory protein UreE (Gene Name=ureE)