Structure of PDB 1gmb Chain A

Receptor sequence

>1gmbA (length=107) Species: 876 (Desulfovibrio desulfuricans)

APAVPDKPVEVKGSQKTVMFPHAPHEKVECVTCHHLVDGKESYAKCGSSG
CHDDLTAKKGEKSLYYVVHARGELKHTSCLACHSKVVAEKPELKKDLTGC
AKSKCHP

3D structure

• PDB: 1gmb Conformational Component in the Coupled Transfer of Multiple Electrons and Protons in a Monomeric Tetraheme Cytochrome
• Chain: A
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	P2 V4 P5 F20 H22 H25 V28 C30 C33 H34 Y43 K45 C46	P2 V4 P5 F20 H22 H25 V28 C30 C33 H34 Y43 K45 C46
BS02	HEC	A	C33 H34 H35 V37 A44 C46 C51 H52 E61 V67 L74 K75 H76	C33 H34 H35 V37 A44 C46 C51 H52 E61 V67 L74 K75 H76
BS03	HEC	A	F20 H25 C79 C82 H83 K90 L93 L97 K104	F20 H25 C79 C82 H83 K90 L93 L97 K104
BS04	HEC	A	V11 G13 S14 Q15 K16 V18 L64 Y65 V68 H69 H83 L97 T98 G99 C100 C105 H106	V11 G13 S14 Q15 K16 V18 L64 Y65 V68 H69 H83 L97 T98 G99 C100 C105 H106
BS05	SO4	A	D6 K7 P8 P21 H22 A23	D6 K7 P8 P21 H22 A23

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

External links

• PDB: RCSB:1gmb, PDBe:1gmb, PDBj:1gmb
• PDBsum: 1gmb
• PubMed: 11551953
• UniProt: Q9L915