Structure of PDB 1glu Chain A

Receptor sequence
>1gluA (length=81) Species: 10116 (Rattus norvegicus) [Search protein sequence]
MKPARPCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCI
IDKIRRKNCPACRYRKCLQAGMNLEARKTKK
3D structure
PDB1glu Crystallographic analysis of the interaction of the glucocorticoid receptor with DNA.
ChainA
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A G458 R466 Y474 R489 K490 R496 G25 R33 Y41 R56 K57 R63
BS02 dna A C450 H451 Y452 K461 K511 T512 K514 C17 H18 Y19 K28 K78 T79 K81
BS03 ZN A C440 C443 C460 C7 C10 C27
BS04 ZN A C476 C492 C495 C43 C59 C62
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1glu, PDBe:1glu, PDBj:1glu
PDBsum1glu
PubMed1865905
UniProtP06536|GCR_RAT Glucocorticoid receptor (Gene Name=Nr3c1)

[Back to BioLiP]