Structure of PDB 1glq Chain A

Receptor sequence
>1glqA (length=209) Species: 10090 (Mus musculus) [Search protein sequence]
PPYTIVYFPVRGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLKPTCLYG
QLPKFEDGDLTLYQSNAILRHLGRSLGLYGKNQREAAQMDMVNDGVEDLR
GKYVTLIYTNYENGKNDYVKALPGHLKPFETLLSQNQGGKAFIVGDQISF
ADYNLLDLLLIHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPEHVN
RPINGNGKQ
3D structure
PDB1glq Molecular structure at 1.8 A of mouse liver class pi glutathione S-transferase complexed with S-(p-nitrobenzyl)glutathione and other inhibitors.
ChainA
Resolution1.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Y7 R13 R18
Catalytic site (residue number reindexed from 1) Y7 R13 R18
Enzyme Commision number 2.5.1.18: glutathione transferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GTB A Y7 F8 V10 I35 W38 K44 Q51 L52 Q64 S65 Y7 F8 V10 I35 W38 K44 Q51 L52 Q64 S65
Gene Ontology
Molecular Function
GO:0004364 glutathione transferase activity
GO:0008432 JUN kinase binding
GO:0016740 transferase activity
GO:0019207 kinase regulator activity
Biological Process
GO:0000302 response to reactive oxygen species
GO:0002674 negative regulation of acute inflammatory response
GO:0006629 lipid metabolic process
GO:0006693 prostaglandin metabolic process
GO:0006749 glutathione metabolic process
GO:0006805 xenobiotic metabolic process
GO:0009636 response to toxic substance
GO:0014003 oligodendrocyte development
GO:0031100 animal organ regeneration
GO:0031667 response to nutrient levels
GO:0032355 response to estradiol
GO:0032691 negative regulation of interleukin-1 beta production
GO:0032720 negative regulation of tumor necrosis factor production
GO:0032869 cellular response to insulin stimulus
GO:0032872 regulation of stress-activated MAPK cascade
GO:0032873 negative regulation of stress-activated MAPK cascade
GO:0032930 positive regulation of superoxide anion generation
GO:0033591 response to L-ascorbic acid
GO:0035726 common myeloid progenitor cell proliferation
GO:0043066 negative regulation of apoptotic process
GO:0043124 negative regulation of canonical NF-kappaB signal transduction
GO:0043200 response to amino acid
GO:0045471 response to ethanol
GO:0048147 negative regulation of fibroblast proliferation
GO:0051122 hepoxilin biosynthetic process
GO:0051771 negative regulation of nitric-oxide synthase biosynthetic process
GO:0070372 regulation of ERK1 and ERK2 cascade
GO:0070373 negative regulation of ERK1 and ERK2 cascade
GO:0070664 negative regulation of leukocyte proliferation
GO:0071222 cellular response to lipopolysaccharide
GO:0071364 cellular response to epidermal growth factor stimulus
GO:0071385 cellular response to glucocorticoid stimulus
GO:0071460 cellular response to cell-matrix adhesion
GO:0071638 negative regulation of monocyte chemotactic protein-1 production
GO:1901687 glutathione derivative biosynthetic process
GO:2000429 negative regulation of neutrophil aggregation
GO:2001237 negative regulation of extrinsic apoptotic signaling pathway
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1glq, PDBe:1glq, PDBj:1glq
PDBsum1glq
PubMed8145243
UniProtP19157|GSTP1_MOUSE Glutathione S-transferase P 1 (Gene Name=Gstp1)

[Back to BioLiP]