Structure of PDB 1ga5 Chain A

Receptor sequence
>1ga5A (length=82) Species: 9606 (Homo sapiens) [Search protein sequence]
VLLCKVCGDVASGFHYGVLACEGCKGFFRRSIQQNIQYKRCLKNENCSIV
RINRNRCQQCRFKKCLSVGMSRDAVRFGRIPK
3D structure
PDB1ga5 DNA Deformability as a Recognition Feature in the RevErb Response Element
ChainA
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A F11 H12 Y13 K22 R26 R68 R72 F73 G74 I76 F14 H15 Y16 K25 R29 R72 R76 F77 G78 I80
BS02 dna A E19 G20 F24 R27 R50 N51 Q54 R57 F73 G74 R75 P77 E22 G23 F27 R30 R54 N55 Q58 R61 F77 G78 R79 P81
BS03 ZN A C1 C4 C18 C21 C4 C7 C21 C24
BS04 ZN A C43 C56 C47 C60
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ga5, PDBe:1ga5, PDBj:1ga5
PDBsum1ga5
PubMed11669620
UniProtP20393|NR1D1_HUMAN Nuclear receptor subfamily 1 group D member 1 (Gene Name=NR1D1)

[Back to BioLiP]