Structure of PDB 1g5q Chain A

Receptor sequence
>1g5qA (length=174) Species: 1282 (Staphylococcus epidermidis) [Search protein sequence]
MYGKLLICATASINVININHYIVELKQHFDEVNILFSPSSKNFINTDVLK
LFCDNLYDEIKDPLLNNINIVENHEYILVLPASANTINKIANGICDNLLT
TVCLTGYQKLFIFPNMNIRMWGNPFLQKNIDLLKNNDVKVYSPDMNKSFE
ISSGRYKNNITMPNIENVLNFVLN
3D structure
PDB1g5q Crystal structure of the peptidyl-cysteine decarboxylase EpiD complexed with a pentapeptide substrate.
ChainA
Resolution2.57 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) N67 S153
Catalytic site (residue number reindexed from 1) N67 S153
Enzyme Commision number 4.1.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A N14 N117 S148 F149 E150 I151 S152 Y156 N159 T161 M162 N14 N117 S148 F149 E150 I151 S152 Y156 N159 T161 M162
BS02 peptide A N19 F52 N19 F52
BS03 FMN A T10 A11 S12 I13 S37 F43 S83 N85 N115 M116 T10 A11 S12 I13 S37 F43 S83 N85 N115 M116
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0004633 phosphopantothenoylcysteine decarboxylase activity
GO:0010181 FMN binding
GO:0016829 lyase activity
Biological Process
GO:0015937 coenzyme A biosynthetic process
Cellular Component
GO:0071513 phosphopantothenoylcysteine decarboxylase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1g5q, PDBe:1g5q, PDBj:1g5q
PDBsum1g5q
PubMed11101502
UniProtP30197|EPID_STAEP Epidermin decarboxylase (Gene Name=epiD)

[Back to BioLiP]