Structure of PDB 1g3m Chain A

Receptor sequence
>1g3mA (length=290) Species: 9606 (Homo sapiens) [Search protein sequence]
SELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTW
VSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPR
IVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPG
SFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKE
VIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLS
PFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRT
3D structure
PDB1g3m Crystallographic analysis of a hydroxylated polychlorinated biphenyl (OH-PCB) bound to the catalytic estrogen binding site of human estrogen sulfotransferase.
ChainA
Resolution1.7 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K47 H107 S137
Catalytic site (residue number reindexed from 1) K45 H105 S135
Enzyme Commision number 2.8.2.4: estrone sulfotransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 A3P A K47 G49 T50 T51 W52 R129 S137 Y192 F228 M255 R256 K257 G258 K45 G47 T48 T49 W50 R127 S135 Y190 F226 M253 R254 K255 G256
BS02 PCQ A Y20 F23 P46 F80 K105 H107 F141 V145 A146 Y239 I246 Y18 F21 P44 F78 K103 H105 F139 V143 A144 Y237 I244 MOAD: ic50~0.15nM
Gene Ontology
Molecular Function
GO:0004062 aryl sulfotransferase activity
GO:0004304 estrone sulfotransferase activity
GO:0005496 steroid binding
GO:0005515 protein binding
GO:0008146 sulfotransferase activity
GO:0016740 transferase activity
GO:0047894 flavonol 3-sulfotransferase activity
GO:0050294 steroid sulfotransferase activity
Biological Process
GO:0006068 ethanol catabolic process
GO:0006629 lipid metabolic process
GO:0006711 estrogen catabolic process
GO:0008202 steroid metabolic process
GO:0008210 estrogen metabolic process
GO:0045600 positive regulation of fat cell differentiation
GO:0050427 3'-phosphoadenosine 5'-phosphosulfate metabolic process
GO:0051923 sulfation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0031965 nuclear membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1g3m, PDBe:1g3m, PDBj:1g3m
PDBsum1g3m
PubMed12782487
UniProtP49888|ST1E1_HUMAN Sulfotransferase 1E1 (Gene Name=SULT1E1)

[Back to BioLiP]