Structure of PDB 1g1q Chain A |
>1g1qA (length=160) Species: 9606 (Homo sapiens) [Search protein sequence] |
WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYW IGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSA PGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYG PECEYVRDDD |
|
PDB | 1g1q Insights into the molecular basis of leukocyte tethering and rolling revealed by structures of P- and E-selectin bound to SLe(X) and PSGL-1. |
Chain | A |
Resolution | 2.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
E80 N82 N105 D106 |
E80 N82 N105 D106 |
|
|
|