Structure of PDB 1g15 Chain A

Receptor sequence
>1g15A (length=141) Species: 562 (Escherichia coli) [Search protein sequence]
KQVEIFTDGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAA
IVALEALKEHAEVILSTDSQYVRQGITQWIHNWKARGWKPVKNVDLWQRL
DAALGQHQIKWEWVGHPENERADELARAAAMNPTLEDTGYQ
3D structure
PDB1g15 Co-crystal of Escherichia coli RNase HI with Mn2+ ions reveals two divalent metals bound in the active site.
ChainA
Resolution1.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D10 G11 E48 D70 D134
Catalytic site (residue number reindexed from 1) D8 G9 E46 D68 D123
Enzyme Commision number 3.1.26.4: ribonuclease H.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MN A D10 E48 D70 D8 E46 D68
BS02 MN A D10 D134 D8 D123
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003676 nucleic acid binding
GO:0004519 endonuclease activity
GO:0004523 RNA-DNA hybrid ribonuclease activity
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006401 RNA catabolic process
GO:0043137 DNA replication, removal of RNA primer
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1g15, PDBe:1g15, PDBj:1g15
PDBsum1g15
PubMed11083878
UniProtP0A7Y4|RNH_ECOLI Ribonuclease HI (Gene Name=rnhA)

[Back to BioLiP]