Structure of PDB 1g0o Chain A

Receptor sequence

>1g0oA (length=272) Species: 148305 (Pyricularia grisea)

KYDAIPGPLGPQSASLEGKVALVTGAGRGIGREMAMELGRRGCKVIVNYA
NSTESAEEVVAAIKKNGSDAACVKANVGVVEDIVRMFEEAVKIFGKLDIV
CSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLIL
MGSITGQAKAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGI
KTDMYHAVCREYIPNGENLSNEEVDEYAAVQWSPLRRVGLPIDIARVVCF
LASNDGGWVTGKVIGIDGGACM

3D structure

• PDB: 1g0o Structures of trihydroxynaphthalene reductase-fungicide complexes: implications for structure-based design and catalysis.
• Chain: A
• Resolution: 1.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G40 S164 H175 Y178 K182 Y223
• Catalytic site (residue number reindexed from 1): G29 S153 H164 Y167 K171 Y212
• Enzyme Commision number: 1.1.1.252: tetrahydroxynaphthalene reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NDP	A	G36 R39 G40 I41 A61 N62 S63 N87 V88 N114 S115 G116 M162 S164 Y178 K182 P208 G210 I211 T213 M215	G25 R28 G29 I30 A50 N51 S52 N76 V77 N103 S104 G105 M151 S153 Y167 K171 P197 G199 I200 T202 M204
BS02	PYQ	A	S164 I165 Y178 G210 M215 C220 Y223	S153 I154 Y167 G199 M204 C209 Y212	MOAD: Ki=14nM

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0047039 tetrahydroxynaphthalene reductase activity

Biological Process

• GO:0042438 melanin biosynthetic process

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:1g0o, PDBe:1g0o, PDBj:1g0o
• PDBsum: 1g0o
• PubMed: 11342131
• UniProt: Q12634|T4HR_PYRO7 Tetrahydroxynaphthalene reductase (Gene Name=MGG_02252)