Structure of PDB 1g0n Chain A

Receptor sequence

>1g0nA (length=273) Species: 148305 (Pyricularia grisea)

SKYDAIPGPLGPQSASLEGKVALVTGAGRGIGREMAMELGRRGCKVIVNY
ANSTESAEEVVAAIKKNGSDAACVKANVGVVEDIVRMFEEAVKIFGKLDI
VCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLI
LMGSITGQAKAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGG
IKTDMYHAVCREYIPNGENLSNEEVDEYAAVQWSPLRRVGLPIDIARVVC
FLASNDGGWVTGKVIGIDGGACM

3D structure

• PDB: 1g0n Structures of trihydroxynaphthalene reductase-fungicide complexes: implications for structure-based design and catalysis.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G40 S164 H175 Y178 K182
• Catalytic site (residue number reindexed from 1): G30 S154 H165 Y168 K172
• Enzyme Commision number: 1.1.1.252: tetrahydroxynaphthalene reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NDP	A	G36 R39 G40 I41 A61 N62 S63 V88 N114 S115 G116 I137 M162 Y178 K182 P208 G210 I211 T213 M215	G26 R29 G30 I31 A51 N52 S53 V78 N104 S105 G106 I127 M152 Y168 K172 P198 G200 I201 T203 M205
BS02	PHH	A	S164 Y178 G210 M215 Y216 C220 Y223 W243	S154 Y168 G200 M205 Y206 C210 Y213 W233	MOAD: Ki=25nM

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0047039 tetrahydroxynaphthalene reductase activity

Biological Process

• GO:0042438 melanin biosynthetic process

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:1g0n, PDBe:1g0n, PDBj:1g0n
• PDBsum: 1g0n
• PubMed: 11342131
• UniProt: Q12634|T4HR_PYRO7 Tetrahydroxynaphthalene reductase (Gene Name=MGG_02252)