Structure of PDB 1g0b Chain A

Receptor sequence

>1g0bA (length=141) Species: 9796 (Equus caballus)

VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSH
GSAQVKAHGKKVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKL
LSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVSTVLTSKYR

3D structure

• PDB: 1g0b Interface sliding as illustrated by the multiple quaternary structures of liganded hemoglobin.
• Chain: A
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	F43 H45 H58 K61 L83 L86 H87 L91 N97 F98 L136	F43 H45 H58 K61 L83 L86 H87 L91 N97 F98 L136

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex

External links

• PDB: RCSB:1g0b, PDBe:1g0b, PDBj:1g0b
• PDBsum: 1g0b
• PubMed: 11112521
• UniProt: P01958|HBA_HORSE Hemoglobin subunit alpha (Gene Name=HBA)