Structure of PDB 1fzq Chain A

Receptor sequence
>1fzqA (length=176) Species: 10090 (Mus musculus) [Search protein sequence]
GLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGF
NIKSVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFE
ETGQELTELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDR
VWQIQSCSALTGEGVQDGMNWVCKNV
3D structure
PDB1fzq Structural and biochemical properties show ARL3-GDP as a distinct GTP binding protein.
ChainA
Resolution1.7 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Q71
Catalytic site (residue number reindexed from 1) Q70
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GDP A N27 G29 K30 T31 T32 N126 K127 D129 L130 S159 A160 L161 N26 G28 K29 T30 T31 N125 K126 D128 L129 S158 A159 L160 MOAD: Kd=24nM
PDBbind-CN: -logKd/Ki=7.62,Kd=24nM
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0008017 microtubule binding
GO:0019003 GDP binding
GO:0046872 metal ion binding
Biological Process
GO:0000281 mitotic cytokinesis
GO:0001822 kidney development
GO:0006892 post-Golgi vesicle-mediated transport
GO:0006893 Golgi to plasma membrane transport
GO:0007224 smoothened signaling pathway
GO:0007264 small GTPase-mediated signal transduction
GO:0015031 protein transport
GO:0042073 intraciliary transport
GO:0042461 photoreceptor cell development
GO:0051301 cell division
GO:0060271 cilium assembly
GO:0061512 protein localization to cilium
GO:1903441 protein localization to ciliary membrane
Cellular Component
GO:0000139 Golgi membrane
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005813 centrosome
GO:0005819 spindle
GO:0005856 cytoskeleton
GO:0005876 spindle microtubule
GO:0005881 cytoplasmic microtubule
GO:0005929 cilium
GO:0005930 axoneme
GO:0016020 membrane
GO:0030496 midbody
GO:0032391 photoreceptor connecting cilium
GO:0035869 ciliary transition zone
GO:0036064 ciliary basal body
GO:0042995 cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1fzq, PDBe:1fzq, PDBj:1fzq
PDBsum1fzq
PubMed11188688
UniProtQ9WUL7|ARL3_MOUSE ADP-ribosylation factor-like protein 3 (Gene Name=Arl3)

[Back to BioLiP]