Structure of PDB 1fyk Chain A |
>1fykA (length=88) Species: 28985 (Kluyveromyces lactis) [Search protein sequence] |
ARPAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKH SNFASFVRQLNMYGWHKVQDVKSGNNDSRWEFENERHA |
|
PDB | 1fyk Crystal packing interaction that blocks crystallization of a site-specific DNA binding protein-DNA complex. |
Chain | A |
Resolution | 2.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
A |
P195 A196 K200 |
P3 A4 K8 |
|
|
|
|