Structure of PDB 1fxa Chain A
Receptor sequence
| >1fxaA (length=98) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence] |
| ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCA GKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY |
3D structure
| PDB | 1fxa Crystallization and structure determination to 2.5-A resolution of the oxidized [2Fe-2S] ferredoxin isolated from Anabaena 7120. | ||
| Chain | A | ||
| Resolution | 2.5 Å | ||
| 3D structure |
|
Enzymatic activity
| Enzyme Commision number | ? |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | FES | A | F39 C41 R42 G44 C46 C49 C79 | F39 C41 R42 G44 C46 C49 C79 |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0009055 | electron transfer activity |
| GO:0046872 | metal ion binding |
| GO:0051536 | iron-sulfur cluster binding |
| GO:0051537 | 2 iron, 2 sulfur cluster binding |
