Structure of PDB 1fxa Chain A

Receptor sequence

>1fxaA (length=98) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418)

ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCA
GKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY

3D structure

• PDB: 1fxa Crystallization and structure determination to 2.5-A resolution of the oxidized [2Fe-2S] ferredoxin isolated from Anabaena 7120.
• Chain: A
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	A	F39 C41 R42 G44 C46 C49 C79	F39 C41 R42 G44 C46 C49 C79

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0022900 electron transport chain

External links

• PDB: RCSB:1fxa, PDBe:1fxa, PDBj:1fxa
• PDBsum: 1fxa
• PubMed: 1902376
• UniProt: P0A3C7|FER1_NOSS1 Ferredoxin-1 (Gene Name=petF)