Structure of PDB 1fx9 Chain A

Receptor sequence

>1fx9A (length=124) Species: 9823 (Sus scrofa) [Search protein sequence]

ALWQFRSMIKCAIPGSHPLMDFNNYGCYCGLGGSGTPVDELDRCCETHDN
CYRDAKNLDSCKFLVDNPYTESYSYSCSNTEITCNSKNNACEAFICNCDR
NAAICFSKAPYNKEHKNLDTKKYC

3D structure

PDB

1fx9 Five coplanar anion binding sites on one face of phospholipase A2: relationship to interface binding.

Chain

Resolution

2.0 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

Enzymatic activity

Catalytic site (original residue number in PDB)	Y28 G30 G32 H48 D49 Y52 Y73 D99
Catalytic site (residue number reindexed from 1)	Y28 G30 G32 H48 D49 Y52 Y73 D99
Enzyme Commision number	3.1.1.4: phospholipase A2.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CA	A	Y28 G30 G32 D49	Y28 G30 G32 D49
BS02	SO4	A	R6 H17 P18 L19 M20	R6 H17 P18 L19 M20
BS03	MJI	A	F5 I9 N23 G30 Y69	F5 I9 N23 G30 Y69

Gene Ontology

	Molecular Function
GO:0004623	phospholipase A2 activity
GO:0005102	signaling receptor binding
GO:0005509	calcium ion binding
GO:0005543	phospholipid binding
GO:0016787	hydrolase activity
GO:0032052	bile acid binding
GO:0046872	metal ion binding
GO:0047498	calcium-dependent phospholipase A2 activity

	Biological Process
GO:0002446	neutrophil mediated immunity
GO:0006629	lipid metabolic process
GO:0006633	fatty acid biosynthetic process
GO:0006644	phospholipid metabolic process
GO:0008284	positive regulation of cell population proliferation
GO:0010524	positive regulation of calcium ion transport into cytosol
GO:0016042	lipid catabolic process
GO:0019370	leukotriene biosynthetic process
GO:0030593	neutrophil chemotaxis
GO:0032652	regulation of interleukin-1 production
GO:0032757	positive regulation of interleukin-8 production
GO:0032869	cellular response to insulin stimulus
GO:0035556	intracellular signal transduction
GO:0043406	positive regulation of MAP kinase activity
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0046324	regulation of D-glucose import
GO:0046470	phosphatidylcholine metabolic process
GO:0046471	phosphatidylglycerol metabolic process
GO:0048146	positive regulation of fibroblast proliferation
GO:0050482	arachidonate secretion
GO:0050778	positive regulation of immune response
GO:0051092	positive regulation of NF-kappaB transcription factor activity
GO:1904635	positive regulation of podocyte apoptotic process

	Cellular Component
GO:0005576	extracellular region
GO:0009986	cell surface

External links

PDB	RCSB:1fx9, PDBe:1fx9, PDBj:1fx9
PDBsum	1fx9
PubMed	11170377
UniProt	P00592\|PA21B_PIG Phospholipase A2, major isoenzyme (Gene Name=PLA2G1B)